Web stats for Chryslerkeyreplacementwarren - chryslerkeyreplacementwarren.com
4.67 Rating by ClearWebStats
chryslerkeyreplacementwarren.com is 1 year 5 months 6 hours old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, chryslerkeyreplacementwarren.com is SAFE to browse.
Traffic Report of Chryslerkeyreplacementwarren
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is chryslerkeyreplacementwarren.com server located?
Hosted IP Address:
166.62.88.194
Hosted Country:
US
Location Latitude:
33.6013Location Longitude:
-111.8867Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 166.62.88.194)
Hyundai Key Replacement - guaranteed locks - Katy, TX 77494
Stuck with your car key/ignition anywhere in Katy, Texas? Hyundai key replacement is available 24/7 & will solve this issue in no-time. Just call:
Not Applicable 
$ 8.95
Jeep Key Replacement-Locksmith- Detroit, MI 48213
If you need to replace your car key or your car key is stuck in the ignition, Just call us for these urgent cases & more ,Jeep Key Replacement is here for you.
Not Applicable $ 8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sat, 07 Jan 2023 09:25:50 GMT
Server: Apache
Content-Length: 623
Content-Type: text/html;charset=ISO-8859-1
Date: Sat, 07 Jan 2023 09:25:50 GMT
Server: Apache
Content-Length: 623
Content-Type: text/html;charset=ISO-8859-1
Domain Information for chryslerkeyreplacementwarren.com
| Domain Registrar: |
GODADDY.COM, LLC
|
|---|---|
| Registration Date: | 2022-12-21 1 year 5 months 6 hours ago |
| Last Modified: | 2022-12-21 1 year 5 months 6 hours ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.seozonexperts.com |
|
166.62.88.194 |
United States
|
| ns2.seozonexperts.com |
|
166.62.88.194 |
United States
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| chryslerkeyreplacementwarren.com | A | 14400 |
IP:166.62.88.194 |
| chryslerkeyreplacementwarren.com | NS | 21600 |
Target:ns1.seozonexperts.com |
| chryslerkeyreplacementwarren.com | NS | 21600 |
Target:ns2.seozonexperts.com |
| chryslerkeyreplacementwarren.com | SOA | 21600 |
MNAME:ns1.seozonexperts.com RNAME:info.s166-62-88-194.secureserver.net Serial:2022122002 Refresh:3600 Retry:1800 Expire:1209600 |
| chryslerkeyreplacementwarren.com | MX | 14400 |
Target:chryslerkeyreplacementwarren.com |
| chryslerkeyreplacementwarren.com | TXT | 14400 |
TXT:v=spf1 +a +mx +ip4:166.62.88.194 ~all |
Similarly Ranked Websites to Chryslerkeyreplacementwarren
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
1 $ 8,833,062,960.00
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
1 $ 8,833,062,960.00
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
1 $ 8,833,062,960.00
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
1 $ 8,833,062,960.00
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
1 $ 8,833,062,960.00
Full WHOIS Lookup for chryslerkeyreplacementwarren.com
Domain Name: CHRYSLERKEYREPLACEMENTWARREN.COM
Registry Domain ID: 2746154394_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2022-12-21T12:15:25Z
Creation Date: 2022-12-21T08:52:11Z
Registry Expiry Date: 2023-12-21T08:52:11Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.SEOZONEXPERTS.COM
Name Server: NS2.SEOZONEXPERTS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-01-07T09:25:46Z
Registry Domain ID: 2746154394_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2022-12-21T12:15:25Z
Creation Date: 2022-12-21T08:52:11Z
Registry Expiry Date: 2023-12-21T08:52:11Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.SEOZONEXPERTS.COM
Name Server: NS2.SEOZONEXPERTS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-01-07T09:25:46Z